Choose a country to view content specific to your location
BNP belongs to a family of protein hormones called natriuretic peptides. It is formed when its precursor, proBNP is proteolytically cleaved into BNP (biologically active) and NT-proBNP (not biologically active). Both BNP and NT-proBNP are released in response to changes in pressure inside the heart which can be related to heart failure and other cardiac problems. BNP is useful both in the diagnosis and prognosis of heart failure and is considered to be a gold standard biomarker in heart failure. Levels of BNP can be measured quantitively using a two-site sandwich ELISA or CLIA assay.
Contact us to learn more about Meridian’s molecular or immunoassay reagent portfolio. We want to hear from you!
| Name | Type | Format | Host/Source | Isotype | Tested Apps | Unit | Catalog | Buffer | Immunogen | Recombinant | Description | Notes | Safety Data Sheet | COA/Test Release | Product Information Sheet | New Product | Recommended Product | Order a Sample | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| MAb to BNP | Monoclonal | Purified | Mouse | IgG1 | EIA,Pr,WB | MG | H86262M | Phosphate Buffered Saline, pH 7.4 | Synthetic BNP peptide 11FGRKMDRISSSS22, conjugated with carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr,CLI | MG | H01413M | Phosphate Buffered Saline, pH 7.4 | Synthetic BNP peptide a.a. 3 15 conjugated to a carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP Complex | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr | MG | H01394M | Phosphate Buffered Saline, pH 7.4 | Immune complex formed by Fab-fragment of BNP-specific H86245M and synthetic human BNP. | No | Monoclonal Antibody to Human BNP and proBNP Complex | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| Pro-BNP Recombinant | Antigen | Purified | E. coli | N/A | EIA | MG | R01614 | 20 mM Na3PO4, 150 mM NaCl, 50% Glycerol, 0.5 M Urea, 2 mM PMSF, 1 mM 4-(2-Aminoethyl) Benzenesulfonyl Fluoride (AEBSF), pH 7.4 | Yes | Pro-BNP, Recombinant Pro-Brain Natriuretic Peptide (pro-BNP), Recombinant Accession #P16860 (108 a.a. with N-terminal His tag.) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | |||||
| Rabbit anti BNP | Polyclonal | Neat | Rabbit | N/A | EIA,RIA,IFA,ICC | ML | K4A660R | Not Applicable | Synthetic human Brain Natriuretic Polypeptide covalently attached to a carrier protein (bovine thyroglobulin). | No | Rabbit Antibody to Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| Rabbit anti BNP | Polyclonal | Purified | Rabbit | N/A | EIA,IHC,RIA | ML | K4A670R | Lyophilized from 1X PBS, pH 7.2. | Synthetic human Brain Natriuretic Polypeptide covalently attached to a carrier protein (bovine thyroglobulin). | No | Rabbit Antibody to Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG1 | WB,EIA | MG | H86916M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 46 60 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP) (a.a. 46 60). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,Pr,WB | MG | H86915M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 13 27 of the proBNP sequence | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP) (a.a. 13 27) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr | MG | H86912M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 1 12 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP) (a.a. 1 12). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,Pr | MG | H86705M | Phosphate Buffered Saline, pH 7.4 | Synthetic NT-proBNP peptide corresponding to amino acids 13-27. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP) (a.a. 13-27). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr,WB | MG | H86573M | Phosphate Buffered Saline, pH 7.4 | Synthetic BNP (whole molecule) conjugated with carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG2b | EIA,Pr,WB | MG | H86511M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 13-27 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP) (a.a.r 13-27). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr,WB | MG | H86507M | Phosphate Buffered Saline, pH 7.4 | Synthetic BNP (whole molecule) conjugated with carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG2b | EIA,Pr,WB | MG | H86451M | Phosphate Buffered Saline, pH 7.4 | Synthetic N-terminal proBNP peptide, corresponding to amino acids 61-76 coupled to a carrier protein. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide N-Terminal (NT-proBNP) (a.a. 61-76). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Biotin | Mouse | IgG2b | EIA,LF,WB | MG | H86451B | 20 mM Tris-HCl, pH 7.5 containing 150 mM Sodium Chloride. | Synthetic N-terminal proBNP peptide, corresponding to amino acids 61-76 coupled to a carrier protein. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide N-terminal (NT-proBNP) (a.a. 61-76). Biotin Conjugated | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA | MG | H86288M | PBS, pH 7.4 | Synthetic NT-proBNP peptide corresponding to amino acids 61-76 | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP) (a.a. 61-76) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr,WB | MG | H86214M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 61-76. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP), amino acids 61-76. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr,WB | MG | H86132M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 13-27. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP), amino acids 13-27. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,WB | MG | H86010M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide, corresponding to amino acids 28-45 (LSELQVEQTSLEPLQESP) of the proBNP sequence. | No | Monoclonal Antibody to Human Pro Brain Natriuretic Peptide, N-terminal (NT-proBNP), amino acids 28-45. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro-BNP N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,WB | MG | H86056M | PBS, pH 7.4 | Synthetic peptide, corresponding to amino acids 1-12 of the proBNP sequence. | No | Monoclonal Antibody to Human pro Brain Natriuretic Peptide, N-terminal (NT-proBNP), amino acids 1-12. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP | Monoclonal | Purified | Mouse | IgG1 | EIA,Pr,WB | MG | H86051M | Phosphate Buffered Saline, pH 7.4 | Synthetic BNP (whole molecule), conjugated with carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,WB,Pr | MG | H01424M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 22-36 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP), amino acids 25-34. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,WB,Pr | MG | H01423M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 13-27 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP), amino acids 15-20. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA,WB,Pr | MG | H01422M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 1 12 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP) amino acids 5-12. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA,WB,Pr | MG | H01421M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 61-76. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP) amino acids 67-76. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG2b | EIA,WB,Pr | MG | H01420M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 61-76 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP), amino acids 61-76. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG2a | EIA,WB,Pr | MG | H01419M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 13-27. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP), amino acids 15-20. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Pro BNP N-terminal | Monoclonal | Purified | Mouse | IgG2b | EIA,WB,Pr | MG | H01418M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to amino acids 13-27 of the proBNP sequence. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-Terminal (NT-proBNP, amino acids 13-24. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP | Monoclonal | Purified | Mouse | IgG1 | EIA,Pr,CLI | MG | H01415M | Phosphate Buffered Saline, pH 7.4 | Synthetic whole molecule human BNP conjugated to a carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Fab24C5-BNP Complex | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr | MG | H01366M | Phosphate Buffered Saline, pH 7.4 | Immune complex formed by Fab-fragment of BNP-specific Mab H01365M and synthetic human BNP | No | Monoclonal Antibody to Human BNP and proBNP in immune complex with Catalog # H01365M | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to BNP | Monoclonal | Purified | Mouse | IgG1 | EIA,Pr,CLI | MG | H01365M | Phosphate Buffered Saline, pH 7.4 | Synthetic BNP 11FGRKMDRISSSS22, conjugated with carrier protein. | No | Monoclonal Antibody to Human Brain Natriuretic Peptide (BNP) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to ProBNP, N-terminal | Monoclonal | Purified | Mouse | IgG1 | EIA,WB,Pr | MG | H01364M | Phosphate Buffered Saline, pH 7.4 | Synthetic peptide corresponding to a.a. 13.27. | No | Monoclonal Antibody to Human pro-Brain Natriuretic Peptide, N-terminal (NT-proBNP), a.a. 13-27. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| MAb to Fab24c5-BNP Complex | Monoclonal | Purified | Mouse | IgG2a | EIA,Pr | MG | H01255M | Phosphate Buffered Saline, pH 7.4 | Immune complex formed by Fab-fragment of BNP-specific H86245M and synthetic human BNP. | No | MAb to BNP/proBNP Complex Monoclonal Antibody to Human BNP / proBNP Complex | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | ||||
| Human pro BNP Rec. Ag | Antigen | Purified | HEK Cells | N/A | EIA,LF | MG | BN1139 | Phosphate Buffered Saline, pH 7.3 | Yes | Human Pro BNP Rec. Ag Human pro BNP Recombinant Antigen, C-Terminal His-Tag Molecular Weight: 13.0 kDa | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | |||||
| Human Pro-BNP (1-108) Recomb. | Antigen | Purified | E. coli | N/A | N/A | MG | A24108H | Lyophilized from 200 mM Ammonium Acetate, pH 7.0. | Yes | Recombinant Human pro-Brain Natriuretic Peptide (proBNP), (amino acids 1-108). Molecular Weight: 12,183 Da. Sequence: GRAPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVA TEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHM (underlined amino acids were added during production and differ from the original sequence). | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | |||||
| Human ProBNP, N-terminal | Antigen | Purified | Synthetic | N/A | N/A | MG | A24607H | Not applicable | No | Human pro-Brain Natriuretic Peptide (proBNP), N-terminal (amino acids 1-76) | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | |||||
| Human ProBNP, N-term. Recomb. | Antigen | Purified | E. coli | N/A | N/A | MG | A24760H | Lyophilized from 200 mM Ammonium Acetate, pH 7.0. | Yes | Recombinant Human pro-Brain Natriuretic Peptide (proBNP), N-terminal (amino acids 1-76). Molecular weight 8,390 Da. Does not contain a fusion partner. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 | |||||
| ProBNP, Recombinant | Antigen | Purified | E. coli | N/A | EIA,CAL | MG | A01455H | 10 mM Potassium Phosphate containing 150 mM Sodium Chloride, pH 7.4. | Yes | Pro-Brain Natriuretic Peptide (proBNP), Recombinant This recombinant contains one additional Methionine residue at the N-Terminus (in comparison with native proBNP). It also contains one intramolecular disulfide bond between residues Cys87 and Cys103. | Safety Data Sheet — | COA/Test Release | — | 0 | 0 |
| Capture Antibody | Detection Antibody |
|---|---|
| H86705M | H86290M |
| H86573M | H01415M |
| H86511M | H86214M |
| H86451M | H86915M |
| H86051M | H01364M |
| H01422M | H01424M |
| H01420M | H01423M |
| H01418M | H01421M |
| H01365M | H01394M |
Not seeing what you’re looking for? Inquire about a new product
Have questions about a product? Want to learn more about Meridian’s molecular or immunoassay reagent portfolio? We want to hear from you!
By submitting your information in this form, you agree that your personal information may be stored and processed in any country where we have facilities or service providers, and by using our “Contact Us” page you agree to the transfer of information to countries outside of your country of residence, including to the United States, which may provide for different data protection rules than in your country. The information you submit will be governed by our Privacy Statement.
| Type |
|---|
| Format |
| Host/Source |
| Isotype |
| Tested Apps |
| Unit |
| Catalog |
| Buffer |
| Immunogen |
| COFA Description |
| COFA Notes |
| Recombination |
| SDS |
| COA |
| Product Information Sheet |
| Request Sample |